HORDB

General Information

ID: hor006421
Uniprot ID: P29794
Protein name: Glicentin-related polypeptide
Gene name: GCG
Organism: Canis lupus familiaris (Dog) (Canis familiaris)
Family: Glucagon family
Source: Animal
Expression: Glucagon release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. GLP-1 and GLP-2 are induced in response to nutrient ingestion (By similarity). |Glucagon is secreted in the A cells of the islets of Langerhans. GLP-
Disease: NA
Comments: NA
Taxonomy: Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0031769 glucagon receptor binding
GO BP: GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway; GO:0010737 protein kinase A signaling; GO:0014823 response to activity; GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus; GO:0042593 glucose homeostasis; GO:0043066 negative regulation of apoptotic process; GO:0050796 regulation of insulin secretion; GO:0050896 response to stimulus
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

Sequence: RSLQDTEEKSRSFSAPQTEPLNDLDQMNED
Length: 30(21-50)
Propeptide: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSAPQTEPLNDLDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEEFRRRHADGSFSDEMNTVLDTLATRDFINWLLQTKITDRK
Signal peptide: MKSIYFVAGLFVMLVQGSWQ
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Activity

Function: [Glucagon]: Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypogl
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
Kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-P29794-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006421_AF2.pdb

hor006421_ESM.pdb

Physical Information

Mass:	399910	Formula:	C142H226N42O58S
Absent amino acids:	CGHIVWY	Common amino acids:	DES
pI:	3.86	Basic residues:	3
Polar residues:	8	Hydrophobic residues:	5
Hydrophobicity:	-161	Boman Index:	-12425
Half-Life / Aliphatic Index:	1 hour	Aliphatic Index:	42.33
Instability Index:	10704.33	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

Literature

PubMed ID: 11916259
Title: cDNA cloning of proglucagon from the stomach and pancreas of the dog.
PubMed ID: 3238052
Title: Immunoreactive glucagons purified from dog pancreas, stomach and ileum.
PubMed ID: 10499540
Title: Proglucagon processing profile in canine L cells expressing endogenous prohormone convertase 1/3 and prohormone
PubMed ID: 12554744
Title:
PubMed ID: 12626323
Title:
PubMed ID: 10322410
Title:
PubMed ID: 10605628
Title: